PDB entry 1r9o

View 1r9o on RCSB PDB site
Description: Crystal Structure of P4502C9 with Flurbiprofen bound
Class: oxidoreductase
Keywords: P450, monooxygenase, drug metabolizing enzyme, oxidoreductase, heme
Deposited on 2003-10-30, released 2004-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2C9
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2C9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11712 (Start-472)
      • engineered (472)
      • expression tag (473-474)
    Domains in SCOPe 2.07: d1r9oa1, d1r9oa2
  • Heterogens: HEM, FLP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r9oA (A:)
    makktssgrgklppgptplpvignilqigikdisksltnlskvygpvftlyfglkpivvl
    hgyeavkealidlgeefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmg
    krsiedrvqeearclveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnl
    meklnenikilsspwiqicnnfspiidyfpgthnkllknvafmksyilekvkehqesmdm
    nnpqdfidcflmkmekekhnqpseftieslentavdlfgagtettsttlryalllllkhp
    evtakvqeeiervigrnrspcmqdrshmpytdavvhevqryidllptslphavtcdikfr
    nylipkgttilisltsvlhdnkefpnpemfdphhfldeggnfkkskyfmpfsagkricvg
    ealagmelflfltsilqnfnlkslvdpknldttpvvngfasvppfyqlcfipihhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r9oA (A:)
    rgklppgptplplqigikdisksltnlskvygpvftlyfglkpivvlhgyeavkealidl
    geefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgkrsiedrvqeear
    clveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlmeklnenikilss
    pwipiidyfpgthnkllknvafmksyilekvkehqesmdmnnpqdfidcflmkmekekhn
    qpseftieslentavdlfgagtettsttlryalllllkhpevtakvqeeiervigrnrsp
    cmqdrshmpytdavvhevqryidllptslphavtcdikfrnylipkgttilisltsvlhd
    nkefpnpemfdphhfldeggnfkkskyfmpfsagkricvgealagmelflfltsilqnfn
    lkslvdpknldttpvvngfasvppfyqlcfipihh