PDB entry 1r9m

View 1r9m on RCSB PDB site
Description: Crystal Structure of Human Dipeptidyl Peptidase IV at 2.1 Ang. Resolution.
Class: hydrolase
Keywords: aminopeptidase, serine protease, glycoprotein, hydrolase
Deposited on 2003-10-30, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r9ma1, d1r9ma2
  • Chain 'B':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (5-732)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d1r9mb1, d1r9mb2, d1r9mb3
  • Chain 'C':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r9mc1, d1r9mc2
  • Chain 'D':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r9md1, d1r9md2
  • Heterogens: NAG, MAN, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r9mA (A:)
    hhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflens
    tfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntq
    wvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysa
    lwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvnt
    dslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydes
    sgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkd
    ctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnper
    cqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskk
    ldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteni
    ivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsygg
    yvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsrae
    nfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiyt
    hmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r9mA (A:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r9mB (B:)
    hhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflens
    tfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntq
    wvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysa
    lwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvnt
    dslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydes
    sgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkd
    ctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnper
    cqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskk
    ldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteni
    ivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsygg
    yvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsrae
    nfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiyt
    hmshfikqcfslp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r9mC (C:)
    hhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflens
    tfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntq
    wvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysa
    lwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvnt
    dslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydes
    sgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkd
    ctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnper
    cqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskk
    ldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteni
    ivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsygg
    yvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsrae
    nfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiyt
    hmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r9mC (C:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r9mD (D:)
    hhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflens
    tfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntq
    wvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysa
    lwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvnt
    dslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydes
    sgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkd
    ctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnper
    cqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskk
    ldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteni
    ivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsygg
    yvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsrae
    nfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiyt
    hmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r9mD (D:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslp