PDB entry 1r9k

View 1r9k on RCSB PDB site
Description: Representative solution structure of the catalytic domain of SopE2
Class: cell invasion
Keywords: Salmonella, invasion, type III, GEF, SopE, CELL INVASION
Deposited on 2003-10-30, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TypeIII-secreted protein effector: invasion-associated protein
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: SopE2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r9ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r9kA (A:)
    gnasegravltsktvkdfmlqklnsldikgnaskdpayarqtceailsavysnnkdqcck
    lliskgvsitpflkeigeaaqnaglpgeikngvftpggaganpfvvpliasasikyphmf
    inhnqqvsfkayaekivmkevtplfnkgtmptpqqfqltieniankylqnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r9kA (A:)
    egravltsktvkdfmlqklnsldikgnaskdpayarqtceailsavysnnkdqcckllis
    kgvsitpflkeigeaaqnaglpgeikngvftpggaganpfvvpliasasikyphmfinhn
    qqvsfkayaekivmkevtplfnkgtmptpqqfqltieniankylqnas