PDB entry 1r9h

View 1r9h on RCSB PDB site
Description: structural genomics of c.elegans: fkbp-type peptidylprolyl isomerase
Deposited on 2003-10-29, released 2003-12-02
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-02, with a file datestamp of 2003-12-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r9ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r9hA (A:)
    msgekiditpkkdggvlklikkegqgvvkpttgttvkvhyvgtlengtkfdssrdrgdqf
    sfnlgrgnvikgwdlgvatmtkgevaeftirsdygygdagsppkipggatlifevelfew
    saedispdrdgtilr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r9hA (A:)
    kiditpkkdggvlklikkegqgvvkpttgttvkvhyvgtlengtkfdssrdrgdqfsfnl
    grgnvikgwdlgvatmtkgevaeftirsdygygdagsppkipggatlifevelfewsa