PDB entry 1r9g

View 1r9g on RCSB PDB site
Description: Three-dimensional Structure of YaaE from Bacillus subtilis
Class: transferase
Keywords: triad amidotransferase, glutaminase, alpha/beta protein, cofactor biosynthesis
Deposited on 2003-10-29, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.24
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yaaE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YAAE, BSU00120
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37528 (20-215)
      • modified residue (20)
      • modified residue (71)
      • modified residue (81)
      • modified residue (94)
      • modified residue (205)
    Domains in SCOPe 2.08: d1r9ga_
  • Chain 'B':
    Compound: Hypothetical protein yaaE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YAAE, BSU00120
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37528 (20-215)
      • modified residue (20)
      • modified residue (71)
      • modified residue (81)
      • modified residue (94)
      • modified residue (205)
    Domains in SCOPe 2.08: d1r9gb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r9gA (A:)
    mgsshhhhhhssglvprgshmltigvlglqgavrehihaieacgaaglvvkrpeqlnevd
    glilpggesttmrrlidtyqfmeplrefaaqgkpmfgtcagliilakeiagsdnphlgll
    nvvvernsfgrqvdsfeadltikgldepftgvfiraphileagenvevlsehngrivaak
    qgqflgcsfhpeltedhrvtqlfvemveeykqkalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r9gA (A:)
    mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq
    fmeplrefaaqgkpmfgtcagliilakeiagsdnphlgllnvvvernsfgrqvdsfeadl
    tikgldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfhpeltedhrvt
    qlfvemveeykqkalv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r9gB (B:)
    mgsshhhhhhssglvprgshmltigvlglqgavrehihaieacgaaglvvkrpeqlnevd
    glilpggesttmrrlidtyqfmeplrefaaqgkpmfgtcagliilakeiagsdnphlgll
    nvvvernsfgrqvdsfeadltikgldepftgvfiraphileagenvevlsehngrivaak
    qgqflgcsfhpeltedhrvtqlfvemveeykqkalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r9gB (B:)
    mltigvlglqgavrehihaieacgaaglvvkrpeqlnevdglilpggesttmrrlidtyq
    fmeplrefaaqgkpmfgtcagliilakeiagsdnphlgllnvvvernsfgrqvdsfeadl
    tikgldepftgvfiraphileagenvevlsehngrivaakqgqflgcsfhpeltedhrvt
    qlfvemveeykqkalv