PDB entry 1r9f

View 1r9f on RCSB PDB site
Description: crystal structure of p19 complexed with 19-bp small interfering rna
Deposited on 2003-10-28, released 2004-01-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.212
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r9fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r9fA (A:)
    gshmtspfklpdespswtewrlhndetnsnqdnplgfkeswgfgkvvfkrylrydrteas
    lhrvlgswtgdsvnyaasrffgfdqigctysirfrgvsitvsggsrtlqhlcemairskq
    emlqmapievesnvsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r9fA (A:)
    hmtspfklpdespswtewrlhndetqdnplgfkeswgfgkvvfkrylrydrteaslhrvl
    gswtgdsvnyaasrffgfdqigctysirfrgvsitvsggsrtlqhlcemairskqemlqm
    a