PDB entry 1r95

View 1r95 on RCSB PDB site
Description: Crystal Structure of IscA (native)
Class: metal transport
Keywords: tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-asymmetric motifs, metal transport
Deposited on 2003-10-28, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein yfhF
    Species: Escherichia coli [TaxId:562]
    Gene: YFHF, B2528, C3053, Z3795, ECS3394, SF2575, S2747
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r95a_
  • Chain 'B':
    Compound: Protein yfhF
    Species: Escherichia coli [TaxId:562]
    Gene: YFHF, B2528, C3053, Z3795, ECS3394, SF2575, S2747
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r95b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r95A (A:)
    msitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgv
    kvvvdgkslqfldgtqldfvkeglnegfkftnpnvkdecgcgesfklaaaldhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r95A (A:)
    msitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgv
    kvvvdgkslqfldgtqldfvkeglnegfkftnpnvkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r95B (B:)
    msitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgv
    kvvvdgkslqfldgtqldfvkeglnegfkftnpnvkdecgcgesfklaaaldhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r95B (B:)
    msitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgv
    kvvvdgkslqfldgtqldfvkeglnegfkftnpnvkd