PDB entry 1r8x

View 1r8x on RCSB PDB site
Description: Crystal Structure of Mouse Glycine N-Methyltransferase (Tetragonal Form)
Class: transferase
Keywords: Glycine N-Methyltransferase, TRANSFERASE
Deposited on 2003-10-28, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine n-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8xa_
  • Chain 'B':
    Compound: glycine n-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8xb_
  • Heterogens: BME, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r8xA (A:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgrdgspgfskfrl
    syyphclasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8xA (A:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvgfskfrlsyyphclas
    ftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r8xB (B:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgrdgspgfskfrl
    syyphclasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8xB (B:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgfskfrlsyyphcla
    sftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd