PDB entry 1r8u

View 1r8u on RCSB PDB site
Description: NMR structure of CBP TAZ1/CITED2 complex
Class: transcription/transcription activator
Keywords: zinc-binding motifs, protein-protein complex, TAZ zinc finger, TRANSCRIPTION/TRANSCRIPTION ACTIVATOR COMPLEX
Deposited on 2003-10-28, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cbp/p300-interacting transactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CITED2, MRG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8ua_
  • Chain 'B':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAL87531 (0-99)
    Domains in SCOPe 2.07: d1r8ub_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r8uA (A:)
    tdfideevlmslviemgldrikelpelwlgqnefdfmtdfvckqqpsrvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r8uB (B:)
    atgptadpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqa
    gkacqvahcassrqiishwknctrhdcpvclplknasdkr