PDB entry 1r8s

View 1r8s on RCSB PDB site
Description:
Deposited on 2003-10-28, released 2004-01-20
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.159
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1r8sa_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1r8se_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r8sA (A:)
    mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
    wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
    eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8sA (A:)
    mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
    wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
    eitdklglhslrhrnwyiqatcatsgdglyegldwlsnql
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1r8sE (E:)
    leanegsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnkt
    aigdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgkaqkidrmmeafaq
    ryclcnpgvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpee
    llrnlydsirnepfkipeddgnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8sE (E:)
    nrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdylgereel
    nlavlhafvdlheftdlnlvqalrqflwsfrlpgkaqkidrmmeafaqryclcnpgvfqs
    tdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnlydsirne
    pfkiped