PDB entry 1r8s

View 1r8s on RCSB PDB site
Description: arf1[delta1-17]-GDP in complex with a sec7 domain carrying the mutation of the catalytic glutamate to lysine
Class: protein transport/exchange factor
Keywords: PROTEIN TRANSPORT/EXCHANGE FACTOR, PROTEIN TRANSPORT-EXCHANGE FACTOR complex
Deposited on 2003-10-28, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 1
    Species: Bos taurus [TaxId:9913]
    Gene: ARF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8sa_
  • Chain 'E':
    Compound: arno
    Species: Homo sapiens [TaxId:9606]
    Gene: PSCD2, ARNO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99418
      • engineered (106)
      • engineered (140-141)
      • engineered (148)
      • engineered (158)
    Domains in SCOPe 2.07: d1r8se_
  • Heterogens: GDP, BME, FMT, SO4, SO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r8sA (A:)
    mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
    wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
    eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8sA (A:)
    mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
    wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
    eitdklglhslrhrnwyiqatcatsgdglyegldwlsnql
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1r8sE (E:)
    leanegsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnkt
    aigdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgkaqkidrmmeafaq
    ryclcnpgvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpee
    llrnlydsirnepfkipeddgnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8sE (E:)
    nrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdylgereel
    nlavlhafvdlheftdlnlvqalrqflwsfrlpgkaqkidrmmeafaqryclcnpgvfqs
    tdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnlydsirne
    pfkiped