PDB entry 1r8r

View 1r8r on RCSB PDB site
Description: arf1[delta 1-17]-GDP-mg in complex with brefeldin a and a sec7 domain
Class: protein transport/exchange factor
Keywords: protein transport/exchange factor
Deposited on 2003-10-28, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-02-10, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 1
    Species: BOS TAURUS
    Gene: ARF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8ra_
  • Chain 'E':
    Compound: arno
    Species: HOMO SAPIENS
    Gene: PSCD2, ARNO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99418
      • modified residue (124)
      • engineered (140-141)
      • engineered (148)
      • engineered (158)
    Domains in SCOPe 2.07: d1r8re_
  • Heterogens: MG, GDP, AFB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r8rA (A:)
    mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
    wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
    eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8rA (A:)
    mrilmvgldaagkttilyklktiptigfnvetveyknisftvwdvggqdkirplwrhyfq
    ntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaaeitdkl
    glhslrhrnwyiqatcatsgdglyegldwlsnqlr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1r8rE (E:)
    leanegsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnkt
    aigdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaq
    ryclcnpgvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpee
    llrnlydsirnepfkipeddgnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8rE (E:)
    ktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdylg
    ereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcnp
    gvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnlyd
    sirnepfkipedd