PDB entry 1r8n

View 1r8n on RCSB PDB site
Description: The Crystal Structure of the Kunitz (STI) Type Inhibitor from Seeds of Delonix regia
Class: hydrolase inhibitor
Keywords: Kunitz-type trypsin/kallikrein inhibitor, X-ray structure, beta-trefoil fold, flamboyant, Delonix regia, HYDROLASE INHIBITOR
Deposited on 2003-10-27, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.215
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kunitz trypsin inhibitor
    Species: Delonix regia [TaxId:72433]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r8na_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r8nA (A:)
    sdaekvydiegypvflgseyyivsaiigaggggvrpgrtrgsmcpmsiiqeqsdlqmglp
    vrfsspeekqgkiytdteleiefvekpdcaesskwvivkdsgearvaiggsedhpqgelv
    rgffkieklgslayklvfcpksdsgscsdiginyegrrslvlkssddvpfrvvfvkprsg
    setes