PDB entry 1r8m

View 1r8m on RCSB PDB site
Description: sec7 domain of the arf exchange factor arno with brefeldin a-sensitizing mutations
Class: Exchange Factor
Keywords: Exchange Factor
Deposited on 2003-10-27, released 2004-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: arno
    Species: Homo sapiens [TaxId:9606]
    Gene: PSCD2, ARNO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99418
      • modified residue (124)
      • engineered (140-141)
      • engineered (148)
      • engineered (158)
    Domains in SCOPe 2.08: d1r8me_
  • Heterogens: MN, FMT, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1r8mE (E:)
    leanegsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnkt
    aigdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaq
    ryclcnpgvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpee
    llrnlydsirnepfkipeddgnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8mE (E:)
    eanegsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnkta
    igdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqr
    yclcnpgvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeel
    lrnlydsirnepfkip