PDB entry 1r8j

View 1r8j on RCSB PDB site
Description: Crystal Structure of Circadian Clock Protein KaiA from Synechococcus elongatus
Class: Circadian Clock Protein
Keywords: KaiA, Circadian Clock Protein
Deposited on 2003-10-26, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.213
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KaiA
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: KaiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF6 (6-End)
      • cloning artifact (5)
    Domains in SCOPe 2.07: d1r8ja1, d1r8ja2, d1r8ja3
  • Chain 'B':
    Compound: KaiA
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: KaiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF6 (6-End)
      • cloning artifact (5)
    Domains in SCOPe 2.07: d1r8jb1, d1r8jb2, d1r8jb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r8jA (A:)
    amadivlsqiaiciwvestailqdcqralsadryqlqvcesgemlleyaqthrdqidcli
    lvaanpsfravvqqlcfegvvvpaivvgdrdsedpdepakeqlyhsaelhlgihqleqlp
    yqvdaalaeflrlapvetmadhimlmganhdpelssqqrdlaqrlqerlgylgvyykrdp
    drflrnlpayesqklhqamqtsyreivlsyfspnsnlnqsidnfvnmaffadvpvtkvve
    ihmelmdefakklrvegrsedilldyrltlidviahlcemyrrsipret
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8jA (A:)
    vlsqiaiciwvestailqdcqralsadryqlqvcesgemlleyaqthrdqidclilvaan
    psfravvqqlcfegvvvpaivvgdrdpakeqlyhsaelhlgihqleqlpyqvdaalaefl
    rlapvetmadhimlmdpelssqqrdlaqrlqerlgylgvyykrdpdrflrnlpayesqkl
    hqamqtsyreivlsyfspnsnlnqsidnfvnmaffadvpvtkvveihmelmdefakklrv
    egrsedilldyrltlidviahlcemyrrsipr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r8jB (B:)
    amadivlsqiaiciwvestailqdcqralsadryqlqvcesgemlleyaqthrdqidcli
    lvaanpsfravvqqlcfegvvvpaivvgdrdsedpdepakeqlyhsaelhlgihqleqlp
    yqvdaalaeflrlapvetmadhimlmganhdpelssqqrdlaqrlqerlgylgvyykrdp
    drflrnlpayesqklhqamqtsyreivlsyfspnsnlnqsidnfvnmaffadvpvtkvve
    ihmelmdefakklrvegrsedilldyrltlidviahlcemyrrsipret
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8jB (B:)
    vlsqiaiciwvestailqdcqralsadryqlqvcesgemlleyaqthrdqidclilvaan
    psfravvqqlcfegvvvpaivvgdpakeqlyhsaelhlgihqleqlpyqvdaalaeflrl
    apvetmadpelssqqrdlaqrlqerlgylgvyykrdpdrflrnlpayesqklhqamqtsy
    reivlsyfspnsnlnqsidnfvnmaffadvpvtkvveihmelmdefakklrvegrsedil
    ldyrltlidviahlcemyrrsipr