PDB entry 1r8i

View 1r8i on RCSB PDB site
Description: Crystal structure of TraC
Class: structural protein
Keywords: TraC, VirB5, helical bundle, STRUCTURAL PROTEIN
Deposited on 2003-10-24, released 2004-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.263
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TraC
    Species: Escherichia coli [TaxId:562]
    Gene: trac
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r8iA (A:)
    giivsnptelikqgeqleqmaqqleqlksqletqknmyesmakttnlgdllgtstntlan
    nlpdnwkevysdamnssssvtpsvnsmmgqfnaevddmtpseaiaymnkklaekgaydrv
    maekaynnqmqelsdmqalteqikstpdlksiadlqariqtsqgaiqgeqaklnlmnmlq
    qsqdkllraqkdratrnfvfgtggdvtaspsin
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8iA (A:)
    telikqgeqleqmaqqleqlksqletqknmyesmakttnlgdllgtstntlannlpdnwk
    evysdamnssssvtpsvnsmmgqfnaevddmtpseaiaymnkklaekgaydrvmaekayn
    nqmqelsdmqalteqikstpdlksiadlqariqtsqgaiqgeqaklnlmnmlqqsqdkll
    raqkdra