PDB entry 1r8e

View 1r8e on RCSB PDB site
Description: Crystal Structure of BmrR Bound to DNA at 2.4A Resolution
Class: transcription/DNA
Keywords: protein-DNA complex, merr-family transcription activator, multidrug-binding protein, transcription-DNA complex
Deposited on 2003-10-23, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: multidrug-efflux transporter regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bmrr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8ea1, d1r8ea2
  • Chain 'B':
    Compound: 5'-d(*gp*ap*cp*cp*cp*tp*cp*cp*cp*cp*tp*tp*ap*gp*gp*gp*gp*ap*gp*gp*gp*tp*c)-3'
  • Heterogens: P4P, IMD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r8eA (A:)
    mkesyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslk
    yigtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa
    lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
    sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
    adrqltvvsdvyeliipihyspkkqeeyrvemkiriae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8eA (A:)
    esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi
    gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypalg
    evfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpytsi
    demtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyiad
    rqltvvsdvyeliipihyspkkqeeyrvemkiria
    

  • Chain 'B':
    No sequence available.