PDB entry 1r8b

View 1r8b on RCSB PDB site
Description: Crystal Structures of an Archaeal Class I CCA-Adding Enzyme and Its Nucleotide
Class: transferase
Keywords: CCA Adding Enzyme, Incoming nucleotide, nucleotidyltransferase
Deposited on 2003-10-23, released 2003-12-16
The last revision prior to the SCOP 1.73 freeze date was dated 2003-12-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA nucleotidyltransferase
    Species: Archaeoglobus fulgidus
    Gene: CCA, AF2156
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1r8ba1, d1r8ba2, d1r8ba3
  • Heterogens: MN, MG, NA, CL, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r8bA (A:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd