PDB entry 1r89

View 1r89 on RCSB PDB site
Description: Crystal Structures of an Archaeal Class I CCA-Adding Enzyme and Its Nucleotide Complexes
Class: transferase
Keywords: CCA Adding Enzyme, Incoming nucleotide, nucleotidyltransferase superfamily, TRANSFERASE
Deposited on 2003-10-23, released 2003-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA nucleotidyltransferase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: CCA, AF2156
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r89a1, d1r89a2, d1r89a3
  • Heterogens: MN, NA, CL, MG, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r89A (A:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd