PDB entry 1r88

View 1r88 on RCSB PDB site
Description: The crystal structure of Mycobacterium tuberculosis MPT51 (FbpC1)
Class: immune system
Keywords: Mycobacterium tuberculosis, alfa/beta hydrolase fold, antigen 85, MPT51, FBPC1
Deposited on 2003-10-23, released 2003-12-30
The last revision prior to the SCOP 1.75 freeze date was dated 2003-12-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.19
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MPT51/MPB51 antigen
    Species: Mycobacterium tuberculosis
    Gene: fbpC1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1r88a_
  • Chain 'B':
    Compound: MPT51/MPB51 antigen
    Species: Mycobacterium tuberculosis
    Gene: fbpC1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1r88b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r88A (A:)
    maeptakaapyenlmvpspsmgrdipvaflaggphavylldafnagpdvsnwvtagnamn
    tlagkgisvvapaggaysmytnweqdgskqwdtflsaelpdwlaanrglapgghaavgaa
    qggygamalaafhpdrfgfagsmsgflypsntttngaiaagmqqfggvdtngmwgapqlg
    rwkwhdpwvhasllaqnntrvwvwsptnpgasdpaamigqaaeamgnsrmfynqyrsvgg
    hnghfdfpasgdngwgswapqlgamsgdivgairhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r88A (A:)
    aapyenlmvpspsmgrdipvaflaggphavylldafnagpdvsnwvtagnamntlagkgi
    svvapaggaysmytnweqdgskqwdtflsaelpdwlaanrglapgghaavgaaqggygam
    alaafhpdrfgfagsmsgflypsntttngaiaagmqqfggvdtngmwgapqlgrwkwhdp
    wvhasllaqnntrvwvwsptnpgasdpaamigqaaeamgnsrmfynqyrsvgghnghfdf
    pasgdngwgswapqlgamsgdivgair
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r88B (B:)
    maeptakaapyenlmvpspsmgrdipvaflaggphavylldafnagpdvsnwvtagnamn
    tlagkgisvvapaggaysmytnweqdgskqwdtflsaelpdwlaanrglapgghaavgaa
    qggygamalaafhpdrfgfagsmsgflypsntttngaiaagmqqfggvdtngmwgapqlg
    rwkwhdpwvhasllaqnntrvwvwsptnpgasdpaamigqaaeamgnsrmfynqyrsvgg
    hnghfdfpasgdngwgswapqlgamsgdivgairhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r88B (B:)
    aapyenlmvpspsmgrdipvaflaggphavylldafnagpdvsnwvtagnamntlagkgi
    svvapaggaysmytnweqdgskqwdtflsaelpdwlaanrglapgghaavgaaqggygam
    alaafhpdrfgfagsmsgflypsntttngaiaagmqqfggvdtngmwgapqlgrwkwhdp
    wvhasllaqnntrvwvwsptnpgasdpaamigqaaeamgnsrmfynqyrsvgghnghfdf
    pasgdngwgswapqlgamsgdivgair