PDB entry 1r86

View 1r86 on RCSB PDB site
Description: Crystal structure of the extracellular xylanase from Geobacillus stearothermophilus T-6 (XT6, monoclinic form): The E159A/E265A mutant at 1.8A resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-10-23, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: xynA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40943 (Start-378)
      • engineered (158)
      • engineered (264)
    Domains in SCOPe 2.07: d1r86a1
  • Heterogens: ZN, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r86A (A:)
    knadsyakkphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenv
    mkpisiqpeegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnet
    dpvkreqnkqlllkrlethiktiverykddikywdvvnavvgddgklrnspwyqiagidy
    ikvafqaarkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqig
    wpseaeiektinmfaalgldnqitaldvsmygwpprayptydaipkqkfldqaarydrlf
    klyeklsdkisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapf
    vfgpdykvkpaywaiidhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r86A (A:)
    kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp
    eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn
    kqlllkrlethiktiverykddikywdvvnavvgddgklrnspwyqiagidyikvafqaa
    rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpseaeie
    ktinmfaalgldnqitaldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd
    kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv
    kpaywaiidhk