PDB entry 1r7s

View 1r7s on RCSB PDB site
Description: PUTIDAREDOXIN (Fe2S2 ferredoxin), C73G mutant
Class: electron transfer
Keywords: electron transfer, cytochrome p450cam, ferredoxin, iron-sulfur cluster
Deposited on 2003-10-22, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-105)
      • engineered (72)
    Domains in SCOPe 2.07: d1r7sa_
  • Chain 'B':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-105)
      • engineered (72)
    Domains in SCOPe 2.07: d1r7sb_
  • Chain 'C':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-105)
      • engineered (72)
    Domains in SCOPe 2.07: d1r7sc_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r7sA (A:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlegvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r7sB (B:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlegvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r7sC (C:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlegvtaelkpnsrlccqiimtpeldgivvdvpdrqw