PDB entry 1r7r

View 1r7r on RCSB PDB site
Description:
Deposited on 2003-10-22, released 2003-12-16
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: 0.327
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r7rA (A:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlygaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r7rA (A:)
    lkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt
    csdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylk
    pyfleayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeee
    slnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliar
    avanetgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekt
    hgeverrivsqlltlmdglkahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrl
    eilqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetid
    aevmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypve
    hpdkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgesean
    vreifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdnvfiigatn
    rpdiidpailrpgrldqliyiplpdeksrvailkanlrksdvdleflakmtngfsgadlt
    eicqracklairespvpeirrdh