PDB entry 1r7r

View 1r7r on RCSB PDB site
Description: The crystal structure of murine p97/VCP at 3.6A
Class: transport protein
Keywords: p97, VCP, AAA, CDC48, TRANSPORT PROTEIN
Deposited on 2003-10-22, released 2003-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Mus musculus [TaxId:10090]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r7ra1, d1r7ra2, d1r7ra3, d1r7ra4
  • Heterogens: ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r7rA (A:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlygaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r7rA (A:)
    lkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt
    csdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylk
    pyfleayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeee
    slnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliar
    avanetgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekt
    hgeverrivsqlltlmdglkahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrl
    eilqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetid
    aevmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypve
    hpdkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgesean
    vreifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdnvfiigatn
    rpdiidpailrpgrldqliyiplpdeksrvailkanlrksdvdleflakmtngfsgadlt
    eicqracklairespvpeirrdh