PDB entry 1r7j

View 1r7j on RCSB PDB site
Description: Crystal structure of the DNA-binding protein Sso10a from Sulfolobus solfataricus
Class: DNA binding protein
Keywords: Winged helix-turn-helix, two-stranded antiparallel coiled coil, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, DNA BINDING PROTEIN
Deposited on 2003-10-21, released 2004-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.232
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Conserved hypothetical protein Sso10a
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: Sso10a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5W1E8
      • see remark 999 (3)
      • see remark 999 (50)
      • see remark 999 (71)
      • see remark 999 (74)
    Domains in SCOPe 2.08: d1r7ja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r7jA (A:)
    akkkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymlt
    kkgeelledirkfnemrknmdqlkekinsvlsirq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r7jA (A:)
    kkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymltkk
    geelledirkfnemrknmdqlkekinsvls