PDB entry 1r7i

View 1r7i on RCSB PDB site
Description: HMG-CoA Reductase from P. mevalonii, native structure at 2.2 angstroms resolution.
Deposited on 2003-10-21, released 2003-11-11
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.256
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r7iA (A:)
    msldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfel
    pyavasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivg
    iqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivd
    vrdamgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefs
    geaviegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsgh
    ygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavav
    glaqnlgamralategiqrghmalharniavvagargdevdwvarqlveyhdvradrava
    llkqkrgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r7iA (A:)
    ldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpy
    avasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivgiq
    dplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivdvr
    damgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefsge
    aviegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsghyg
    slttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavavgl
    aqnlgamralat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r7iB (B:)
    msldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfel
    pyavasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivg
    iqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivd
    vrdamgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefs
    geaviegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsgh
    ygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavav
    glaqnlgamralategiqrghmalharniavvagargdevdwvarqlveyhdvradrava
    llkqkrgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r7iB (B:)
    ldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpy
    avasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivgiq
    dplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivdvr
    damgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefsge
    aviegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsghyg
    slttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavavgl
    aqnlgamralategi