PDB entry 1r7h

View 1r7h on RCSB PDB site
Description: NrdH-redoxin of Corynebacterium ammoniagenes forms a domain-swapped dimer
Class: electron transport
Keywords: nrdh, thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport
Deposited on 2003-10-21, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.245
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NrdH-redoxin
    Species: Corynebacterium ammoniagenes [TaxId:1697]
    Gene: nrdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r7ha_
  • Chain 'B':
    Compound: NrdH-redoxin
    Species: Corynebacterium ammoniagenes [TaxId:1697]
    Gene: nrdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r7hb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r7hA (A:)
    msitlytkpacvqctatkkaldraglayntvdislddeardyvmalgyvqapvvevdgeh
    wsgfrperikqlqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r7hA (A:)
    msitlytkpacvqctatkkaldraglayntvdislddeardyvmalgyvqapvvevdgeh
    wsgfrperikqlqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r7hB (B:)
    msitlytkpacvqctatkkaldraglayntvdislddeardyvmalgyvqapvvevdgeh
    wsgfrperikqlqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r7hB (B:)
    msitlytkpacvqctatkkaldraglayntvdislddeardyvmalgyvqapvvevdgeh
    wsgfrperikqlqa