PDB entry 1r7g

View 1r7g on RCSB PDB site
Description: NMR structure of the membrane anchor domain (1-31) of the nonstructural protein 5A (NS5A) of hepatitis C virus (Minimized average structure, Sample in 100mM DPC)
Class: membrane protein
Keywords: Membrane anchor domain, HCV NS5A protein, NMR structure, peptide., MEMBRANE PROTEIN
Deposited on 2003-10-21, released 2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r7ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r7gA (A:)
    sgswlrdiwdwicevlsdfktwlkaklmpql