PDB entry 1r79

View 1r79 on RCSB PDB site
Description: Solution Structure of The C1 Domain of The Human Diacylglycerol Kinase Delta
Class: transferase
Keywords: C1 Domain, Cystein-rich Zinc Binding Domain, Diacylglycerol Kinase Delta, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2003-10-21, released 2004-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diacylglycerol kinase, delta
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA ha00914
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16760 (7-77)
      • cloning artifact (0-6)
      • cloning artifact (78-83)
    Domains in SCOPe 2.07: d1r79a1, d1r79a2, d1r79a3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1r79A (A:)
gssgssgttlasigkdiiedadgiamphqwlegnlpvsakctvcdktcgsvlrlqdwrcl
wckamvhtsckeslltkcsgpssg