PDB entry 1r71

View 1r71 on RCSB PDB site
Description: Crystal Structure of the DNA binding domain of KorB in complex with the operator DNA
Class: transcription/DNA
Keywords: IncP, plasmid partitioning, protein-DNA complex, heilx-turn-helix motif, transcription factor, ParB homologue, TRANSCRIPTION-DNA COMPLEX
Deposited on 2003-10-17, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional repressor protein KorB
    Species: Escherichia coli [TaxId:562]
    Gene: korb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r71a_
  • Chain 'B':
    Compound: Transcriptional repressor protein KorB
    Species: Escherichia coli [TaxId:562]
    Gene: korb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r71b_
  • Chain 'C':
    Compound: Transcriptional repressor protein KorB
    Species: Escherichia coli [TaxId:562]
    Gene: korb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r71c_
  • Chain 'D':
    Compound: Transcriptional repressor protein KorB
    Species: Escherichia coli [TaxId:562]
    Gene: korb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r71d_
  • Chain 'E':
    Compound: 5'-d(*ap*(bru)p*tp*tp*tp*ap*gp*cp*gp*gp*cp*tp*ap*ap*ap*ap*g)-3'
  • Chain 'F':
    Compound: 5'-d(*cp*(bru)p*tp*tp*tp*ap*gp*cp*cp*gp*cp*tp*ap*ap*ap*ap*(bru))-3'
  • Chain 'G':
    Compound: 5'-d(*ap*(bru)p*tp*tp*tp*ap*gp*cp*gp*gp*cp*tp*ap*ap*ap*ap*g)-3'
  • Chain 'H':
    Compound: 5'-d(*cp*(bru)p*tp*tp*tp*ap*gp*cp*cp*gp*cp*tp*ap*ap*ap*ap*(bru))-3'
  • Chain 'I':
    Compound: 5'-d(*cp*(bru)p*tp*tp*tp*ap*gp*cp*cp*gp*cp*tp*ap*ap*ap*ap*(bru))-3'
  • Chain 'J':
    Compound: 5'-d(*ap*(bru)p*tp*tp*tp*ap*gp*cp*gp*gp*cp*tp*ap*ap*ap*ap*g)-3'
  • Chain 'K':
    Compound: 5'-d(*ap*(bru)p*tp*tp*tp*ap*gp*cp*gp*gp*cp*tp*ap*ap*ap*ap*g)-3'
  • Chain 'L':
    Compound: 5'-d(*cp*(bru)p*tp*tp*tp*ap*gp*cp*cp*gp*cp*tp*ap*ap*ap*ap*(bru))-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r71A (A:)
    ryrgskwagkksipafidndyneadqvienlqrneltpreiadfigrelakgkkkgdiak
    eigkspafitqhvtlldlpekiadafntgrvrdvtvvnelvtafkkrpeeveawldddtq
    eitrgtvkllrefldekgrdpntvdafngqtdaerdaeagdgqdgedgdqdgkdakek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r71A (A:)
    eadqvienlqrneltpreiadfigrelakgkkkgdiakeigkspafitqhvtlldlpeki
    adafntgrvrdvtvvnelvtafkkrpeeveawldddtqeitrgtvkllreflde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r71B (B:)
    ryrgskwagkksipafidndyneadqvienlqrneltpreiadfigrelakgkkkgdiak
    eigkspafitqhvtlldlpekiadafntgrvrdvtvvnelvtafkkrpeeveawldddtq
    eitrgtvkllrefldekgrdpntvdafngqtdaerdaeagdgqdgedgdqdgkdakek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r71B (B:)
    yneadqvienlqrneltpreiadfigrelakgkkkgdiakeigkspafitqhvtlldlpe
    kiadafntgrvrdvtvvnelvtafkkrpeeveawldddtqeitrgtvkllreflde
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r71C (C:)
    ryrgskwagkksipafidndyneadqvienlqrneltpreiadfigrelakgkkkgdiak
    eigkspafitqhvtlldlpekiadafntgrvrdvtvvnelvtafkkrpeeveawldddtq
    eitrgtvkllrefldekgrdpntvdafngqtdaerdaeagdgqdgedgdqdgkdakek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r71C (C:)
    adqvienlqrneltpreiadfigrelakgkkkgdiakeigkspafitqhvtlldlpekia
    dafntgrvrdvtvvnelvtafkkrpeeveawldddtqeitrgtvkllrefld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r71D (D:)
    ryrgskwagkksipafidndyneadqvienlqrneltpreiadfigrelakgkkkgdiak
    eigkspafitqhvtlldlpekiadafntgrvrdvtvvnelvtafkkrpeeveawldddtq
    eitrgtvkllrefldekgrdpntvdafngqtdaerdaeagdgqdgedgdqdgkdakek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r71D (D:)
    neadqvienlqrneltpreiadfigrelakgkkkgdiakeigkspafitqhvtlldlpek
    iadafntgrvrdvtvvnelvtafkkrpeeveawldddtqeitrgtvkllreflde
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.