PDB entry 1r6y

View 1r6y on RCSB PDB site
Description: Crystal structure of YgiN from Escherichia coli
Deposited on 2003-10-17, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-07, with a file datestamp of 2005-01-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1r6ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6yA (A:)
    mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
    vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpgisgrvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6yA (A:)
    mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
    vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpg