PDB entry 1r6y

View 1r6y on RCSB PDB site
Description: Crystal structure of YgiN from Escherichia coli
Class: Structural genomics, Unknown function
Keywords: structural genomics, hypothetical protein, functional annotation, ferredoxin-like fold, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Unknown function
Deposited on 2003-10-17, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ygiN
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r6ya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6yA (A:)
    mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
    vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpgisgrvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6yA (A:)
    mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
    vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpg