PDB entry 1r6x

View 1r6x on RCSB PDB site
Description: The Crystal Structure of a Truncated Form of Yeast ATP Sulfurylase, Lacking the C-Terminal APS Kinase-like Domain, in complex with Sulfate
Class: transferase
Keywords: APS Kinase-like Domain
Deposited on 2003-10-17, released 2003-11-11
The last revision prior to the SCOP 1.73 freeze date was dated 2004-03-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.197
AEROSPACI score: -1.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP:sulfate adenylyltransferase
    Species: Saccharomyces cerevisiae
    Gene: MET3, YJR010W, J1436
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1r6xa1, d1r6xa2
  • Heterogens: SO4, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6xA (A:)
    paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
    endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
    kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlrl
    efqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvrv
    yqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknskg
    vdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgtel
    rrrlrvggeipewfsypevvkilresnpprpkgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6xA (A:)
    paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
    endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
    kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlrl
    efqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvrv
    yqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknskg
    vdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgtel
    rrrlrvggeipewfsypevvkilres