PDB entry 1r6w

View 1r6w on RCSB PDB site
Description:
Deposited on 2003-10-17, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.169
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1r6wa1, d1r6wa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6wA (A:)
    shmrsaqvyrwqipmdagvvlrdrrlktrdglyvclregeregwgeisplpgfsqetwee
    aqsvllawvnnwlagdcelpqmpsvafgvscalaeltdtlpqaanyraaplcngdpddli
    lkladmpgekvakvrvglyeavrdgmvvnllleaipdlhlrldanrawtplkgqqfakyv
    npdyrdriafleepcktrddsrafaretgiaiawdeslrepdfafvaeegvravvikptl
    tgslekvreqvqaahalgltavisssiesslgltqlariaawltpdtipgldtldlmqaq
    qvrrwpgstlpvvevdalerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6wA (A:)
    shmrsaqvyrwqipmdagvvldrrlktrdglyvclregeregwgeisplpgfsqetweea
    qsvllawvnnwlagdcelpqmpsvafgvscalaeltdtlpqaanyraaplcngdpddlil
    kladmpgekvakvrvglyeavrdgmvvnllleaipdlhlrldanrawtplkgqqfakyvn
    pdyrdriafleepcktrddsrafaretgiaiawdeslrepdfafvaeegvravvikptlt
    gslekvreqvqaahalgltavisssiesslgltqlariaawltpdtipgldtldlmqaqq
    vrrwpgstlpvvevdalerll