PDB entry 1r6v

View 1r6v on RCSB PDB site
Description: Crystal structure of fervidolysin from Fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin
Class: hydrolase
Keywords: subtilisin, sandwich domain, propeptide, HYDROLASE
Deposited on 2003-10-17, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin-like serine protease
    Species: Fervidobacterium pennivorans [TaxId:93466]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93LQ6 (0-670)
      • engineered (199)
    Domains in SCOPe 2.07: d1r6va_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r6vA (A:)
    skakdlaslpeiksqgyhilfgelrdgeytegkilvgyndrsevdkivkavngkvvlelp
    qikvvsiklngmtvkqaydkikalalkgiryvepsykrelikptvvkpnpdmykirkpgl
    nstardygeelsnelwgleaigvtqqlweeasgtniivavvdtgvdgthpdlegqviagy
    rpafdeelpagtdssyggsagthvagtiaakkdgkgivgvapgakimpivifddpalvgg
    ngyvgddyvaagiiwatdhgakvmnhswggwgysytmkeafdyamehgvvmvvsagnnts
    dshhqypagypgviqvaaldyyggtfrvagfssrsdgvsvgapgvtilstvpgedsigye
    ghnenvpatnggtydyyqgtsmaaphvtgvvavllqkfpnakpwqirkllentafdfngn
    gwdhdtgyglvkldaalqgplptqggveefqvvvtdakgnfgvptvfvsmmrdngscyya
    ktgpdgiarfphidsgtydifvggpdhwdralapydgesipggyaialrmaeerqasfvg
    fgvspdatqlnvnfnstlqvkfstnlstlkdpqfvvvdpllrgvygrvayarnqtydlsl
    lsgqisfgiqtllpaatditiqgtvtlngedipvygvlkagttwtiiddfgglnlgtdsq
    piyvwwtifgq