PDB entry 1r6t

View 1r6t on RCSB PDB site
Description: crystal structure of human tryptophanyl-trna synthetase
Deposited on 2003-10-16, released 2004-01-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-06, with a file datestamp of 2004-01-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6tA (A:)
    mpnsepasllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedyka
    dcppgnpaptsnhgpdateaeedfvdpwtvqtssakgidydklivrfgsskidkelinri
    eratgqrphhflrrgiffshrdmnqvldayenkkpfylytgrgpsseamhvghlipfift
    kwlqdvfnvplviqmtddekylwkdltldqaygdavenakdiiacgfdinktfifsdldy
    mgmssgfyknvvkiqkhvtfnqvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdr
    tdiqclipcaidqdpyfrmtrdvaprigypkpallhstffpalqgaqtkmsasdpnssif
    ltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltffledddkleqirkdy
    tsgamltgelkkalievlqpliaehqarrkevtdeivkefmtprklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6tA (A:)
    asllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedykaedfvdp
    wtvqtssakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvl
    dayenkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdlt
    ldqaygdavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgif
    gftdsdcigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvapri
    gypkpallhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieeh
    rqfggncdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqa
    rrkevtdeivkefmtprkla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r6tB (B:)
    mpnsepasllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedyka
    dcppgnpaptsnhgpdateaeedfvdpwtvqtssakgidydklivrfgsskidkelinri
    eratgqrphhflrrgiffshrdmnqvldayenkkpfylytgrgpsseamhvghlipfift
    kwlqdvfnvplviqmtddekylwkdltldqaygdavenakdiiacgfdinktfifsdldy
    mgmssgfyknvvkiqkhvtfnqvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdr
    tdiqclipcaidqdpyfrmtrdvaprigypkpallhstffpalqgaqtkmsasdpnssif
    ltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltffledddkleqirkdy
    tsgamltgelkkalievlqpliaehqarrkevtdeivkefmtprklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6tB (B:)
    gidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenkkpf
    ylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqaygdav
    enakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsdcig
    kisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpallh
    stffpalqgpnssifltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltf
    fledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevtdeivkefmtprk
    la