PDB entry 1r6t

View 1r6t on RCSB PDB site
Description: crystal structure of human tryptophanyl-tRNA synthetase
Class: ligase
Keywords: Class Ic tRNA synthetase, Rossmann fold catalytical domain, anticodon recognition domain, bound Trp-AMP, LIGASE
Deposited on 2003-10-16, released 2004-01-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: WARS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23381 (Start-465)
      • modified residue (41)
      • modified residue (47)
      • modified residue (142)
      • modified residue (168)
      • modified residue (194)
      • engineered (212-213)
      • modified residue (240)
      • modified residue (242)
      • modified residue (318)
      • modified residue (349)
      • modified residue (400)
      • modified residue (424)
      • modified residue (460)
      • cloning artifact (466)
    Domains in SCOPe 2.08: d1r6ta1, d1r6ta2, d1r6ta3
  • Chain 'B':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: WARS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23381 (Start-465)
      • modified residue (142)
      • modified residue (168)
      • modified residue (194)
      • engineered (212-213)
      • modified residue (240)
      • modified residue (242)
      • modified residue (318)
      • modified residue (400)
      • modified residue (424)
      • modified residue (460)
      • cloning artifact (466)
    Domains in SCOPe 2.08: d1r6tb1, d1r6tb2
  • Heterogens: TYM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6tA (A:)
    mpnsepasllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedyka
    dcppgnpaptsnhgpdateaeedfvdpwtvqtssakgidydklivrfgsskidkelinri
    eratgqrphhflrrgiffshrdmnqvldayenkkpfylytgrgpsseamhvghlipfift
    kwlqdvfnvplviqmtddekylwkdltldqaygdavenakdiiacgfdinktfifsdldy
    mgmssgfyknvvkiqkhvtfnqvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdr
    tdiqclipcaidqdpyfrmtrdvaprigypkpallhstffpalqgaqtkmsasdpnssif
    ltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltffledddkleqirkdy
    tsgamltgelkkalievlqpliaehqarrkevtdeivkefmtprklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6tA (A:)
    asllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedykaedfvdp
    wtvqtssakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvl
    dayenkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdlt
    ldqaygdavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgif
    gftdsdcigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvapri
    gypkpallhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieeh
    rqfggncdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqa
    rrkevtdeivkefmtprkla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r6tB (B:)
    mpnsepasllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedyka
    dcppgnpaptsnhgpdateaeedfvdpwtvqtssakgidydklivrfgsskidkelinri
    eratgqrphhflrrgiffshrdmnqvldayenkkpfylytgrgpsseamhvghlipfift
    kwlqdvfnvplviqmtddekylwkdltldqaygdavenakdiiacgfdinktfifsdldy
    mgmssgfyknvvkiqkhvtfnqvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdr
    tdiqclipcaidqdpyfrmtrdvaprigypkpallhstffpalqgaqtkmsasdpnssif
    ltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltffledddkleqirkdy
    tsgamltgelkkalievlqpliaehqarrkevtdeivkefmtprklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6tB (B:)
    gidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenkkpf
    ylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqaygdav
    enakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsdcig
    kisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpallh
    stffpalqgpnssifltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltf
    fledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevtdeivkefmtprk
    la