PDB entry 1r6r

View 1r6r on RCSB PDB site
Description: Solution Structure of Dengue Virus Capsid Protein Reveals a New Fold
Deposited on 2003-10-16, released 2004-02-17
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r6ra_
  • Chain 'B':
    Domains in SCOP 1.67: d1r6rb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6rA (A:)
    mndqrkkarntpfnmlkrernrvstvqqltkrfslgmlqgrgplklfmalvaflrfltip
    ptagilkrwgtikkskainvlrgfrkeigrmlnilnrrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6rA (A:)
    nrvstvqqltkrfslgmlqgrgplklfmalvaflrfltipptagilkrwgtikkskainv
    lrgfrkeigrmlnilnrrrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r6rB (B:)
    mndqrkkarntpfnmlkrernrvstvqqltkrfslgmlqgrgplklfmalvaflrfltip
    ptagilkrwgtikkskainvlrgfrkeigrmlnilnrrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6rB (B:)
    nrvstvqqltkrfslgmlqgrgplklfmalvaflrfltipptagilkrwgtikkskainv
    lrgfrkeigrmlnilnrrrr