PDB entry 1r6n

View 1r6n on RCSB PDB site
Description: HPV11 E2 TAD complex crystal structure
Class: transcription, replication
Keywords: Papillomavirus; E2 TAD; TAD; X-ray structure; TRANSCRIPTION; REPLICATION, TRANSCRIPTION, REPLICATION
Deposited on 2003-10-15, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hpv11 regulatory protein e2
    Species: Human papillomavirus type 11 [TaxId:10580]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04015 (7-End)
      • expression tag (6)
    Domains in SCOPe 2.07: d1r6na1, d1r6na2
  • Heterogens: 434, ALQ, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6nA (A:)
    ghhhhhheaiakrldacqdqllelyeensidihkhimhwkcirlesvllhkakqmglshi
    glqvvppltvsetkghnaiemqmhleslaktqygvepwtlqdtsyemwltppkrcfkkqg
    ntvevkfdgcednvmeyvvwthiylqdndswvkvtssvdakgiyytcgqfktyyvnfnke
    aqkygstnhwevcygstvicspasvsskkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6nA (A:)
    heaiakrldacqdqllelyeensidihkhimhwkcirlesvllhkakqmglshiglqvvp
    pltvsetkghnaiemqmhleslaktqygvepwtlqdtsyemwltppkrcfkkqgntvevk
    fdgcednvmeyvvwthiylqdndswvkvtssvdakgiyytcgqfktyyvnfnkeaqkygs
    tnhwevcygstvicsp