PDB entry 1r6m

View 1r6m on RCSB PDB site
Description: Crystal Structure Of The tRNA Processing Enzyme Rnase pH From Pseudomonas Aeruginosa In Complex With Phosphate
Class: transferase
Keywords: beta-alpha-beta-alpha fold, hexamer, phosphate bound, transferase
Deposited on 2003-10-15, released 2004-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease PH
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: RPH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r6ma1, d1r6ma2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6mA (A:)
    mnrpsgraadqlrpiritrhytkhaegsvlvefgdtkvictvsaesgvprflkgqgqgwl
    taeygmlprstgernqreasrgkqggrtleiqrligrslraaldlsklgentlyidcdvi
    qadggtrtasitgatvalidalavlkkrgalkgnplkqmvaavsvgiyqgvpvldldyle
    dsaaetdlnvvmtdaggfievqgtaegapfrpaelnamlelaqqgmqelfelqraalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6mA (A:)
    mnrpsgraadqlrpiritrhytkhaegsvlvefgdtkvictvsaesgvprflkqgwltae
    ygmlprstgernqreasrgkqggrtleiqrligrslraaldlsklgentlyidcdviqad
    ggtrtasitgatvalidalavlkkrgalkgnplkqmvaavsvgiyqgvpvldldyledsa
    aetdlnvvmtdaggfievqgtaegapfrpaelnamlelaqqgmqelfelqraalae