PDB entry 1r6l

View 1r6l on RCSB PDB site
Description: Crystal Structure Of The tRNA Processing Enzyme Rnase pH From Pseudomonas Aeruginosa
Deposited on 2003-10-15, released 2004-02-17
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6lA (A:)
    mnrpsgraadqlrpiritrhytkhaegsvlvefgdtkvictvsaesgvprflkgqgqgwl
    taeygmlprstgernqreasrgkqggrtleiqrligrslraaldlsklgentlyidcdvi
    qadggtrtasitgatvalidalavlkkrgalkgnplkqmvaavsvgiyqgvpvldldyle
    dsaaetdlnvvmtdaggfievqgtaegapfrpaelnamlelaqqgmqelfelqraalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6lA (A:)
    mnrpsgraadqlrpiritrhytkhaegsvlvefgdtkvictvsaesgvprflkqgwltae
    ygmlprstgernqreasrgkqggrtleiqrligrslraaldlsklgentlyidcdviqad
    ggtrtasitgatvalidalavlkkrgalkgnplkqmvaavsvgiyqgvpvldldyledsa
    aetdlnvvmtdaggfievqgtaegapfrpaelnamlelaqqgmqelfelqraalae