PDB entry 1r6k

View 1r6k on RCSB PDB site
Description: hpv11 e2 tad crystal structure
Deposited on 2003-10-15, released 2004-02-24
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-24, with a file datestamp of 2004-02-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.257
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r6ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6kA (A:)
    ghhhhhheaiakrldacqdqllelyeensidihkhimhwkcirlesvllhkakqmglshi
    glqvvppltvsetkghnaiemqmhleslaktqygvepwtlqdtsyemwltppkrcfkkqg
    ntvevkfdgcednvmeyvvwthiylqdndswvkvtssvdakgiyytcgqfktyyvnfnke
    aqkygstnhwevcygstvicspasvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6kA (A:)
    aiakrldacqdqllelyeensidihkhimhwkcirlesvllhkakqmglshiglqvvppl
    tvsetkghnaiemqmhleslaktqygvepwtlqdtsyemwltppkrcfkkqgntvevkfv
    meyvvwthiylqdndswvkvtssvdakgiyytcgqfktyyvnfnkeaqkygstnhwevcy
    gstvics