PDB entry 1r6k

View 1r6k on RCSB PDB site
Description: HPV11 E2 TAD crystal structure
Class: transcription, replication
Keywords: Papillomavirus; E2 TAD; TAD domain; X-ray structure; TRANSCRIPTION; REPLICATION, TRANSCRIPTION, REPLICATION
Deposited on 2003-10-15, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.257
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hpv11 regulatory protein e2
    Species: Human papillomavirus type 11 [TaxId:10580]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r6ka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6kA (A:)
    ghhhhhheaiakrldacqdqllelyeensidihkhimhwkcirlesvllhkakqmglshi
    glqvvppltvsetkghnaiemqmhleslaktqygvepwtlqdtsyemwltppkrcfkkqg
    ntvevkfdgcednvmeyvvwthiylqdndswvkvtssvdakgiyytcgqfktyyvnfnke
    aqkygstnhwevcygstvicspasvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6kA (A:)
    aiakrldacqdqllelyeensidihkhimhwkcirlesvllhkakqmglshiglqvvppl
    tvsetkghnaiemqmhleslaktqygvepwtlqdtsyemwltppkrcfkkqgntvevkfv
    meyvvwthiylqdndswvkvtssvdakgiyytcgqfktyyvnfnkeaqkygstnhwevcy
    gstvics