PDB entry 1r6j

View 1r6j on RCSB PDB site
Description: Ultrahigh resolution Crystal Structure of syntenin PDZ2
Deposited on 2003-10-15, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 0.73 Å
R-factor: 0.074
AEROSPACI score: 1.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r6ja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r6jA (A:)
    gamdprtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkd
    sqiadilstsgtvvtitimpaf