PDB entry 1r6e

View 1r6e on RCSB PDB site
Description: Solution structure of the catalytic domain of SopE2
Class: cell invasion
Keywords: Salmonella, invasion, guanine nucleotide exchange factor,type III secretion, CELL INVASION
Deposited on 2003-10-15, released 2004-09-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TypeIII-secreted protein effector: invasion-associated protein
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: SopE2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r6ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1r6eA (A:)
egravltsktvkdfmlqklnsldikgnaskdpayarqtceailsavysnnkdqcckllis
kgvsitpflkeigeaaqnaglpgeikngvftpggaganpfvvpliasasikyphmfinhn
qqvsfkayaekivmkevtplfnkgtmptpqqfqltieniankylqnas