PDB entry 1r6d

View 1r6d on RCSB PDB site
Description: Crystal Structure of DesIV double mutant (dTDP-glucose 4,6-dehydratase) from Streptomyces venezuelae with NAD and DAU bound
Class: lyase
Keywords: Dehydratase, Rossmann Fold, Short-Chain Dehydrogenase/Reductase
Deposited on 2003-10-14, released 2004-01-27
The last revision prior to the SCOP 1.75 freeze date was dated 2004-01-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.176
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TDP-glucose-4,6-dehydratase
    Species: Streptomyces venezuelae
    Gene: DesIV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZGH3 (0-End)
      • engineered (127-128)
      • engineered (286)
    Domains in SCOP 1.75: d1r6da_
  • Heterogens: NAD, DAU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6dA (A:)
    mrllvtggagfigshfvrqllagaypdvpadevivldsltyagnranlapvdadprlrfv
    hgdirdagllarelrgvdaivhfaaeshvdrsiagasvftetnvqgtqtllqcavdagvg
    rvvhvstnqvygsidsgswtessplepnspyaaskagsdlvarayhrtygldvritrccn
    nygpyqhpekliplfvtnlldggtlplygdganvrewvhtddhcrgialvlaggrageiy
    higggleltnreltgilldslgadwssvrkvadrkghdlrysldggkierelgyrpqvsf
    adglartvrwyrenrgwweplkatapqlpatavevsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6dA (A:)
    mrllvtggagfigshfvrqllagaypdvpadevivldsltyagnranlapvdadprlrfv
    hgdirdagllarelrgvdaivhfaaeshvdrsiagasvftetnvqgtqtllqcavdagvg
    rvvhvstnqvygsidsgswtessplepnspyaaskagsdlvarayhrtygldvritrccn
    nygpyqhpekliplfvtnlldggtlplygdganvrewvhtddhcrgialvlaggrageiy
    higggleltnreltgilldslgadwssvrkvadrkghdlrysldggkierelgyrpqvsf
    adglartvrwyrenrgwweplk