PDB entry 1r6b

View 1r6b on RCSB PDB site
Description: High resolution crystal structure of ClpA
Deposited on 2003-10-15, released 2004-08-24
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-24, with a file datestamp of 2004-08-24.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.235
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1r6bX (X:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgtrkdeptqssdpgsqpnseeqaggeerlenfttnlnqla
    rvggidpligrekeleraiqvlcrrrknnpllvgesgvgktaiaeglawrivqgdvpevm
    adctiysldigsllagtkyrgdfekrfkallkqleqdtnsilfideihtiigagaasggq
    vdaanlikpllssgkirvigsttyqefsnifekdralarrfqkiditepsieetvqiing
    lkpkyeahhdvrytakavraavelavkyindrhlpdkaidvideagararlmpvskrkkt
    vnvadiesvvariaripeksvsqsdrdtlknlgdrlkmlvfgqdkaiealteaikmarag
    lghehkpvgsflfagptgvgktevtvqlskalgiellrfdmseymerhtvsrligappgy
    vgfdqgglltdavikhphavllldeiekahpdvfnillqvmdngtltdnngrkadfrnvv
    lvmttnagvreterksiglihqdnstdameeikkiftpefrnrldniiwfdhlstdvihq
    vvdkfivelqvqldqkgvslevsqearnwlaekgydramgarpmarviqdnlkkplanel
    lfgslvdggqvtvaldkekneltygfqsaqkhkaeaah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6bX (X:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishglenfttnlnqlarvggidpligrekeleraiqvlcrrrk
    nnpllvgesgvgktaiaeglawrivqgdvpevmadctiysldigagtkyrgdfekrfkal
    lkqleqdtnsilfideihtiigagaasggqvdaanlikpllssgkirvigsttyqefsni
    fekdralarrfqkiditepsieetvqiinglkpkyeahhdvrytakavraavelavkyin
    drhlpdkaidvideagararlmpvskrkktvnvadiesvvariaripeksvsqsdrdtlk
    nlgdrlkmlvfgqdkaiealteaikmaraglghehkpvgsflfagptgvgktevtvqlsk
    algiellrfdmseymerhtvsrligappgyvgfdqgglltdavikhphavllldeiekah
    pdvfnillqvmdngtltdnngrkadfrnvvlvmttnagvrameeikkiftpefrnrldni
    iwfdhlstdvihqvvdkfivelqvqldqkgvslevsqearnwlaekgydramgarpmarv
    iqdnlkkplanellfgslvdggqvtvaldkekneltygfqsaqk