PDB entry 1r6b

View 1r6b on RCSB PDB site
Description: High resolution crystal structure of ClpA
Class: hydrolase
Keywords: ClpA, AAA+, N-terminal Domain, ClpS, crystal, binding mechanism, HYDROLASE
Deposited on 2003-10-15, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.235
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: ClpA protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABH9 (0-End)
      • engineered (168)
      • see remark 999 (366)
      • see remark 999 (410)
      • see remark 999 (532)
    Domains in SCOPe 2.07: d1r6bx1, d1r6bx2, d1r6bx3
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1r6bX (X:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgtrkdeptqssdpgsqpnseeqaggeerlenfttnlnqla
    rvggidpligrekeleraiqvlcrrrknnpllvgesgvgktaiaeglawrivqgdvpevm
    adctiysldigsllagtkyrgdfekrfkallkqleqdtnsilfideihtiigagaasggq
    vdaanlikpllssgkirvigsttyqefsnifekdralarrfqkiditepsieetvqiing
    lkpkyeahhdvrytakavraavelavkyindrhlpdkaidvideagararlmpvskrkkt
    vnvadiesvvariaripeksvsqsdrdtlknlgdrlkmlvfgqdkaiealteaikmarag
    lghehkpvgsflfagptgvgktevtvqlskalgiellrfdmseymerhtvsrligappgy
    vgfdqgglltdavikhphavllldeiekahpdvfnillqvmdngtltdnngrkadfrnvv
    lvmttnagvreterksiglihqdnstdameeikkiftpefrnrldniiwfdhlstdvihq
    vvdkfivelqvqldqkgvslevsqearnwlaekgydramgarpmarviqdnlkkplanel
    lfgslvdggqvtvaldkekneltygfqsaqkhkaeaah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6bX (X:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishglenfttnlnqlarvggidpligrekeleraiqvlcrrrk
    nnpllvgesgvgktaiaeglawrivqgdvpevmadctiysldigagtkyrgdfekrfkal
    lkqleqdtnsilfideihtiigagaasggqvdaanlikpllssgkirvigsttyqefsni
    fekdralarrfqkiditepsieetvqiinglkpkyeahhdvrytakavraavelavkyin
    drhlpdkaidvideagararlmpvskrkktvnvadiesvvariaripeksvsqsdrdtlk
    nlgdrlkmlvfgqdkaiealteaikmaraglghehkpvgsflfagptgvgktevtvqlsk
    algiellrfdmseymerhtvsrligappgyvgfdqgglltdavikhphavllldeiekah
    pdvfnillqvmdngtltdnngrkadfrnvvlvmttnagvrameeikkiftpefrnrldni
    iwfdhlstdvihqvvdkfivelqvqldqkgvslevsqearnwlaekgydramgarpmarv
    iqdnlkkplanellfgslvdggqvtvaldkekneltygfqsaqk