PDB entry 1r69

View 1r69 on RCSB PDB site
Description: structure of the amino-terminal domain of phage 434 repressor at 2.0 angstroms resolution
Class: gene regulating protein
Keywords: gene regulating protein
Deposited on 1988-12-08, released 1989-10-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: repressor protein ci
    Species: Bacteriophage 434
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1r69a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r69A (A:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngtsdsnvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r69A (A:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngt