PDB entry 1r69

View 1r69 on RCSB PDB site
Description: structure of the amino-terminal domain of phage 434 repressor at 2.0 angstroms resolution
Deposited on 1988-12-08, released 1989-10-15
The last revision prior to the SCOP 1.71 freeze date was dated 1989-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1r69__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download) 
    >1r69_ (-)
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngtsdsnvr

    Sequence, based on observed residues (ATOM records): (download) 
    >1r69_ (-)
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt